Showing 113–128 of 135 results

  • Saline 5ml - 1 Syringe - 0.9% Sodium Chloride

    Saline 5ml – 1 Syringe – 0.9% Sodium Chloride

    $5.41

    5 mL – 1 SYRINGE

  • Sale! Saxenda 3ml/6mg 1 Weight Loss Pen

    Saxenda 3ml/6mg 1 Weight Loss Pen

    Original price was: $304.86.Current price is: $210.01.

    1 PEN ONLY

  • Sale! Sedy Filler 60ml - Body Filler - 1 vial

    Sedy Filler 60ml – Body Filler – 1 vial

    Original price was: $202.06.Current price is: $107.76.

    Sedy Filler 60ml x 1 Vial – Body Filler 
    HA Concentration 20mg / ml

  • Semaglutide

    Semaglutide (cartridge without pen)/ 2mg|5mg/10 vials

    Price range: $150.00 through $283.00

    Semaglutide (GLP-1 RA) 5mg/vial

     

    Semaglutide is a GLP-1 receptor agonist, meaning that it mimics the action of the human incretin glucagon-like peptide-1 (GLP-1), thereby increasing insulin secretion and increasing blood sugar disposal and improving glycemic control.

    It is used as an antidiabetic medication used for the treatment of type 2 diabetes and long-term weight management.

    It reduces food intake by lowering appetite and slowing down digestion in the stomach, helping to reduce body fat.

    Its half-life in the blood is about 7 days.

    Dosages may vary between users, it’s recommended to start with a low dose and titrate until you reach and maintain the desired effects, dosages can range from 0.25 to 2.5 mg per week.

    Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page
  • Semaglutide 5mg-30mg/10vials

    Semaglutide 5mg-30mg/10vials

    Price range: $34.00 through $145.00

    Semaglutide for weight loss

    Semaglutide, under the brand name Wegovy, can be used for weight loss. You’ll need to meet the criteria to take it, such as having a BMI of overweight (27 to 30) and a weight-related medical condition like prediabetes, or a BMI of obese (30 or more).

    Wegovy comes as an injection. Research has shown that people lose up to 21% of their starting weight after taking 7.2mg a week for 72 weeks.

    How does semaglutide work for weight loss?

    Semaglutide works by binding to GLP-1 receptors and mimicking the actions of the natural hormone GLP-1. This means it sends signals to your brain, reducing your appetite and causing the stomach to empty more slowly, making you feel less hungry and fuller for longer.

    Naturally, GLP-1 only does this after eating, but semaglutide taken once a week will continuously reduce your appetite, so you’ll feel less hungry all the time, not just after eating. It works effectively alongside a diet and exercise plan.

    How do you take semaglutide for weight loss?

    Wegovy is an injection that comes in a pre-filled injection pen containing 4 doses. A doctor or nurse can show you how to use it, and you can find more information on injecting Wegovy safely

     

    Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page
  • Sharpsafe Black 0.2 Litre Sharps Bin

    Sharpsafe Black 0.2 Litre Sharps Bin

    $13.54

    Sharpsafe Sharp Bin, 0.2 Litre

  • Survodutide 10mg| 10 vials

    Survodutide 10mg | 10 vials

    Price range: $279.00 through $409.00

    Survodutide 10mg| 10 vials is a premium research peptide developed for laboratory studies focusing on metabolic regulation and energy balance. Supplied in lyophilized form, it ensures precision, consistency, and high purity for structured experimental protocols.

    Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page
  • Tesamorelin (2mg,5mg,10mg,20mg)/10 vials

    Tesamorelin (2mg,5mg,10mg,20mg)/10 vials

    Price range: $43.00 through $471.00

    Tesamorelin Peptide
    Tesamorelin is a synthetic polypeptide composed of 44 amino acids analogous to growth hormone-releasing hormone. The N-terminus of the compound has been modified compared to growth hormone-releasing hormone, the modification of which researchers suggest may lead to improved stability.(1)

    Tesamorelin has been studied for its potential mechanism of action, posited to be similar to growth hormone-releasing hormones (GHRH) receptors located at the anterior pituitary gland, possibly leading to increased production and secretion of growth hormones. Growth hormones may act on several cells, including hepatocytes, stimulating the systemic synthesis of insulin-like growth factor-1 (IGF-1). In addition, growth hormone may also stimulate IGF-1 production locally, inside various tissues.(1)

    Usage and Storage:

    Tesamorelin is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website’s detailed reconstitution and storage guidelines.

    Synthesis and Quality Assurance:

    Tesamorelin is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

    Legal and Safety Information:

    Dermal Fillers Pharm proudly provides Tesamorelin strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including Tesamorelin, are not designed for human consumption or clinical application.

    Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page
  • Testosterone Cypionate

    Testosterone Cypionate

    Price range: $65.00 through $80.00

    What is Testosterone Cypionate?

    Buy Testosterone Cypionate – a synthetic version of testosterone. It is usually taken along with other anabolic steroids for building a massive muscular bulk in a relatively short period of time.

    Testosterone Cypionate is recommended to men with low testosterone levels. Many men start suffering from low T once they cross the age of 30. Taking drugs such as Testosterone Cypionate can help reverse that.

    How Does Testosterone Cypionate Work?

    Testosterone Cypionate is different from the naturally occurring Testosterone hormone as it consists of 8 carbon esters which are harder for the liver to break down.

    This drug should be injected into the intramuscular tissues so that it can be absorbed by the body. Once absorbed, it is stored in the fatty tissues and released as slowly as possible over an extended period of time.

    The amount of Testosterone Cypionate injected into the body should depend on when you’re taking this steroid. If you’re taking these injections during the bulking phase, you should take a higher dosage. If you’re taking this steroid during the cutting phase for fat burning, you should take a smaller dose.

    What this steroid does very well is to allow you to preserve muscle mass even you’re burning fat. But it works only if you maintain a caloric deficit. Since this steroid has a long half-life, its effects persist for much longer than many other anabolic drugs. So, you won’t need to inject cypionate as often as with other injectable steroids.

    Stacking Up

    There is no better or more effective muscle builder than testosterone. Buy Testosterone Cypionate stacks up well with many types of anabolic or androgenic steroids such as Deca Durabolin, Dianabol, Boldenone and Primobolan. It can be used with other drugs such as Nolvadex, HCG, and Clomid to minimize any side effects during the post-cycle therapy.

    How to Take

    How much Testosterone Cypionate you should take will depend on many factors such as your testosterone level, age, gender, weight, and BMI (body mass index).

    If you’re a beginner to bodybuilding, you should take injections of about 25 to 50mg of Testosterone Cypionate about two or three times a week.  It would be a good idea to have the injections performed by a trained physician or nurse.

    If you’re an experienced bodybuilder, then you can take a total of 250 to 1000mg of this steroid each week.

    The typical Testosterone Cypionate lasts for 12 to 14 weeks. Testosterone Cypionate has a half life of 10 to 12 days and its effects last slightly longer than its counterpart, Testosterone Enanthate.

    This drug works much better when stacked with other anabolic steroids, especially with those that have similar characteristics.

    Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page
  • Testosterone Enantate 250mg/1ml Vial POM x3

    Testosterone Enantate 250mg/1ml Vial POM x3

    $75.00

    Testosterone Enantate 250mg

    Testosterone Enantate is a manufactured version of the naturally occurring male sex hormone, testosterone. It is used in adult men for testosterone replacement to treat various health problems caused by a lack of testosterone (male hypogonadism). This should be confirmed by two separate blood testosterone measurements and also include clinical symptoms such as:

    • Impotence

    • Infertility

    • Low sex drive

    • Tiredness

    • Depressive moods

    • Bone loss caused by low hormone levels.

  • TESTOSTERONE ENANTHATE 300MG/ML

    TESTOSTERONE ENANTHATE 300MG/ML

    $80.00

    Testosterone Enanthate 300mg/ml A long-acting injectable anabolic steroid designed to promote muscle growth, enhance strength, and improve overall performance. With its extended half-life, Testosterone Enanthate provides consistent anabolic effects, making it a popular choice for bulking cycles and hormone replacement therapy (HRT). HISTORY OF TESTOSTERONE ENANTHATE Testosterone Enanthate was introduced in the mid-20th century as…

  • Testosterone Enanthate 400mg

    Testosterone Enanthate 400mg

    $80.00

    Description

    Test-E 400mg/ml –

    Test-E 400mg/ml by Nakon Medical is a high-concentration form of testosterone enanthate, a synthetic version of the naturally occurring male hormone testosterone. Widely used for hormone replacement therapy (HRT) and to enhance muscle mass, strength, and athletic performance. Commonly utilized by bodybuilders and athletes during bulking cycles, as it helps increase muscle size, improve recovery, and boost overall physical performance.

  • Testprop100mg/ml

    Testprop100mg/ml

    $65.00

    GP Test Prop is injectable steroid which contains the hormone Testosterone Propionate in preparations of 100 mg per ML.

    The Propionate ester is much faster acting (2-3 days) than Enathate or Cypionate, and thus requires a more frequent injection schedule such as every day or every other day in order to keep blood levels as stable as possible. The benefit to this however, is that the steroid can be cleared from the body much more quickly after use is discontinued, thus making it a more preferable choice for tested athletes. Some bodybuilders also claim that Propionate tends to induce far fewer estrogen related side effects such as bloat than do the other esters of this powerful hormone.

    Testosterone is the most common anabolic hormone that there is and is also considered the most basic. Due to this, bodybuilders often consider it the base steroid to most all cycles. Testosterone is both anabolic and androgenic in nature. Users of GP Test Prop will notice a dramatic gain in muscle size and strength, as well as an overall sense of well being and increases libido and sex drive.

    Testosterone aromatizes very easily and therefore estrogen buildup and side effects can become an issue for users sensitive to these problems or those choosing to use a high dose of this compound. Therefore, when using Testosterone, bodybuilders often choose in incorporate an anti-estrogen such as Anastrozole, Proviron, Tamoxifen to help keep estrogen related side effects to a minimum. Extremely sensitive users, or users using very high doses (800-1200 mg) might find that stronger anti-estrogens such as Letrozole or Exemestane are more suitable. Androgenic side effects such as oily skin are also possible while taking Testosterone.

    Bodybuilders looking to bulk up, often stack GP Test Prop with other steroids such as GP Deca 250 and/or GP Bold 200, along with an oral compound such as GP Methan or GP Oxy. Those Bodybuilders looking to use testosterone during cutting phase, might wish to stack it with compounds such as GP Trens, along with an oral like GP Stan or GP Oxan.

    Testosterone use will quickly shut down the body’s natural production of the hormone, thus making a proper PCT plan essehttp://google.com/ntial for restoring the body’s natural function and maintaining gains as best as possible after use of the steroid has been discontinued. At cycle’s end, bodybuilders often choose to use a combination of Clomid, Tamoxifen, and HCG for a period of 3-4wks in order to restore pituitary gland and testes operation quickly and effectively.

    Woman bodybuilders often use GP Test Prop to build mass, although of course the dosage is significantly less than what males would use due to the possibility of masculizing side effects.

    The male bodybuilder’s dosage of GP Test Prop 100 would typically be in 400-1200 mg per week range and cycle duration would be from 8-20 weeks, depending of course on the goals of the athlete. Women typically see desirable results from doses of 50-100 mg per week.

  • Thymosin Beta 4 TB500 2mg-10mg/10 vials

    Thymosin Beta 4 TB500 2mg-10mg/10 vials

    Price range: $34.00 through $204.00

    TB-500 – High-Quality Research Peptide

    TB-500, offered at 5mg, is a high-quality, specialised research peptide developed for advanced scientific exploration in cellular regeneration and tissue repair. This product is ideal for laboratory settings where precision and reliability are paramount.

    • Product Name: TB-500 5mg
    • Catalogue Number: TB500-5mg
    • Molecular Formula: C212H350N56O78S
    • Molecular Weight: 4963.4 g/mol
    • Purity: ≥98%
    • Sequence:SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
    • Form: Lyophilised Solid

    Usage and Storage:

    TB-500 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website’s detailed reconstitution and storage guidelines.

    Please note that our peptides, including TB-500, are not designed for human consumption or clinical application.

    Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page
  • Tirzepatide (Zepbound and Mounjaro) 2.5mg/5mg/10mg/15mg| 10 vials

    Tirzepatide (Zepbound and Mounjaro) 2.5mg/5mg/10mg/15mg| 10 vials

    Price range: $214.00 through $723.00

    Tirzepatide (Zepbound and Mounjaro) 2.5mg/5mg/10mg/15mg| 10 vials is a high-quality research peptide designed for laboratory studies focusing on dual incretin receptor activity. Supplied in multiple strengths, it offers flexibility, precision, and consistency for structured experimental protocols in metabolic and endocrine research.

    Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page
  • Tirzepatide 5mg-120mg \ 10 Vials

    Tirzepatide 5mg-120mg \ 10 Vials

    Price range: $39.00 through $440.00
    1. Introducing Tirzepatide: A Revolutionary Breakthrough in Diabetes Management. This advanced medication offers a multi-faceted approach to empower individuals in their journey toward better health.

    Key Features:

    1. Comprehensive Blood Sugar Control:Tirzepatide is designed to effectively regulate blood sugar levels, providing a stable foundation for diabetes management.
    2. Weight Management: Experience the potential for weight loss as part of your diabetes treatment plan, supporting overall health and well-being.
    3. Cardiovascular Support: Tirzepatide goes beyond blood sugar control, offering potential cardiovascular benefits and reducing associated risks.
    4. A1c Improvement: Witness improvements in A1c levels, indicating better long-term glucose management.
    5. Enhanced Insulin Sensitivity: Enjoy the benefits of increased insulin sensitivity for improved metabolic function.
    6. Appetite Regulation: Tirzepatide may contribute to appetite regulation, fostering healthier eating habits.
    7. Convenient Once-Weekly Dosing:Simplify your routine with the potential for once-weekly dosing, enhancing medication adherence
    Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page