Showing the single result

  • Thymosin Beta 4 TB500 2mg-10mg/10 vials

    Thymosin Beta 4 TB500 2mg-10mg/10 vials

    Price range: $34.00 through $204.00

    TB-500 – High-Quality Research Peptide

    TB-500, offered at 5mg, is a high-quality, specialised research peptide developed for advanced scientific exploration in cellular regeneration and tissue repair. This product is ideal for laboratory settings where precision and reliability are paramount.

    • Product Name: TB-500 5mg
    • Catalogue Number: TB500-5mg
    • Molecular Formula: C212H350N56O78S
    • Molecular Weight: 4963.4 g/mol
    • Purity: ≥98%
    • Sequence:SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
    • Form: Lyophilised Solid

    Usage and Storage:

    TB-500 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website’s detailed reconstitution and storage guidelines.

    Please note that our peptides, including TB-500, are not designed for human consumption or clinical application.

    Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page