• 5-amino-1mq 5mg/50mg| 10 Vials

    5-amino-1mq 5mg/50mg| 10 Vials

    Price range: $43.00 through $126.00

    5-Amino-1MQ is a small-molecule NNMT (nicotinamide N-methyltransferase) inhibitor that enhances metabolic processes, supports muscle preservation, and promotes anti-aging research.

    PEPTIDE PROFILE

    • Peptide Name: 5-Amino-1MQ

    • Main Function: Boosts metabolism and supports muscle preservation

    • Mechanism of Action: Inhibits NNMT → increases NAD+ → enhances fat oxidation and cellular energy

    KEY FEATURES & BENEFITS

    • Enhances fat metabolism and weight loss

    • Improves insulin sensitivity

    • Supports muscle growth and sarcopenia reversal

    • Promotes anti-aging through metabolic optimization

    • Potential applications in obesity and metabolic disorders

    Select optionsDone This product has multiple variants. The options may be chosen on the product page
  • Cagrilintide 5mg/10mg|10vials

    Cagrilintide 5mg/10mg|10vials

    Price range: $103.00 through $299.00

    Cagrilintide is a synthetic peptide compound intended exclusively for laboratory research use. It is supplied in lyophilized powder form for controlled in vitro studies performed by qualified professionals.

    This is  a cyclic peptide composed of 38 amino acids, with a sequence containing 38 amino acids and a pair of disulfide bonds. Kaglirin can significantly reduce weight and reduce food intake. Kagrelin peptide has potential in obesity research.
    As a non selective amino acid receptor (AMYR) and calcium G protein coupled receptor (CTR) advocate, Cagrinide is a new long acting acetylated amino acid analysis, which is a cyclic peptide composed of 38 amino acids The sequence contains a pair of defective bonds Cagritide can significantly reduce weight and food intake Cagritide has potential in objectivity research.

    Select optionsDone This product has multiple variants. The options may be chosen on the product page
  • GHK-Cu 50mg/100mg| 10 vials

    GHK-Cu 50mg/100mg| 10 vials

    Price range: $26.00 through $69.00

    GHK-Cu 50mg – High-Quality Research Peptide

    GHK-Cu, a tripeptide first identified in human blood, is known for its unique property of containing copper molecules, which gives it alternate names such as Copper Peptide Repair Complex, Copper Tripeptide-1, and GHK Copper. The presence of copper (Cu) imbues the compound with a distinctive shade of blue, making it identifiable in research settings.

    GHK-Cu, we want to clarify that batch colour variations are normal and do not indicate a quality issue. We have been supplying GHK-Cu for many years, and variations from dark blue to lighter shades occur due to different synthesis and environmental factors. The purity and efficacy remain consistently high across batches, and our testing confirms this.

    Usage and Storage:

    GHK-Cu is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For optimal results, consult our website for detailed reconstitution and storage guidelines.

    Synthesis and Quality Assurance:

    This peptide is meticulously synthesised through a controlled process that ensures high purity, making it suitable for advanced scientific studies. Our commitment to excellence guarantees that each batch undergoes stringent quality co

    Select optionsDone This product has multiple variants. The options may be chosen on the product page
  • IGF-1 LR3 0.1mg/1mg| 10 vials

    IGF-1 LR3 0.1mg/1mg| 10 vials

    Price range: $34.00 through $245.00

    IGF-1 LR3 (Long Arginine 3-IGF-1) is a synthetic and lengthened protein analogue of human-like-insulin growth factor 1. It is comprised of 83 amino acids. Dosed at 1 mg for research purposes.

    IGF-1 LR3 (Long R3 Insulin-Like Growth Factor-1)

    This Long R3 variant includes a 13-amino-acid extension and an arginine substitution at position 3. These sequence changes reduce binding to IGF-binding proteins (IGFBPs) and support sustained availability in experimental models.
    For laboratory research only. Not for human use.

    IGF-1 Key features

    • Engineered to minimise IGFBP binding and support consistent readouts in vitro.
    • Supplied as a lyophilised solid for stability and straightforward storage.
    • Unit size: 1 mg per vial.

    Each batch released only after stringent quality checks

    Select optionsDone This product has multiple variants. The options may be chosen on the product page
  • KISSPEPTIN 10 - 5mg/10mg| 10 vials

    KISSPEPTIN 10 – 5mg/10mg| 10 vials

    Price range: $54.00 through $126.00

    Kisspeptin 10 5mg – High-Quality Research Peptide

    Kisspeptin 10, offered at 5mg, is a high-quality specialised research peptide developed for advanced scientific exploration in endocrinology and related fields. This product is ideal for laboratory settings where precision and reliability are paramount.

    • Product Name: Kisspeptin 10 5mg
    • Catalogue Number: KISSPEPTIN 10 – 5mg
    • Molecular Formula: C63H89N19O12
    • Molecular Weight: 1302.5 g/mol
    • Purity: ≥98%
    • Sequence: Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2
    • Form: Lyophilised Solid

    Usage and Storage:

    Kisspeptin 10 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website’s detailed reconstitution and storage guidelines.

    Synthesis and Quality Assurance:

    Kisspeptin 10 is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

    Select optionsDone This product has multiple variants. The options may be chosen on the product page
  • MOTS-C ( 10,20,30,40mg)/10 vails

    MOTS-C ( 10,20,30,40mg)/10 vails

    Price range: $54.00 through $314.00
    • MOTS-c Peptide

    MOTS-c (mitochondrial open-reading-frame of the 12S rRNA-c) peptide is a novel mitochondria-derived peptide. It is a short peptide composed of 16 amino acids, expressed in tissues and plasma, indicating a cell-specific and hormonal role.(1) With the potential to work both as a cell-specific compound and as a hormone, this peptide possibly acts by stimulating the AMP-activated protein kinase (AMPK) pathway. Only two mitochondrial-derived peptides (MDPs) have been studied, Humanin and MOTS-c. When metabolic stress occurs in the organism, the peptide is believed to translocate to the cellular nuclei and alter the gene expression. MOTS-c peptide may also be released extracellularly and is known as “mitochondrial hormone” or simply as “mitokine.” (2)(3)

    Usage and Storage:

    MOTS-c Acetate is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website’s detailed reconstitution and storage guidelines.

    Synthesis and Quality Assurance:

    MOTS-c Acetate is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

    Legal and Safety Information:

    Dermal Fillers Pharms proudly provides MOTS-c Acetate strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including MOTS-c Acetate, are not designed for human consumption or clinical application.

    Select optionsDone This product has multiple variants. The options may be chosen on the product page
  • Mounjaro 12.5mg/2.4ml x 1 Weight Loss Pen

    Mounjaro 2.5mg|5mg|10mg|15mg x 1 Weight Loss Pen

    Price range: $214.00 through $723.00

    Each pre-filled pen contains 12.5 mg of tirzepatide in 0.6 ml solution.

    Select optionsDone This product has multiple variants. The options may be chosen on the product page
  • Retatrutide | 99% Purity | 5mg - 60mg / 10 vials

    Retatrutide | 99% Purity | 5mg – 60mg / 10 vials

    Price range: $64.00 through $644.00

    What Is Retatrutide?

    Similar to other GLP-1 medications, retatrutide is an injectable medication that targets hormone receptors in your body that directly impact metabolism and appetite. Retatrutide targets three different receptors:

    • GLP-1 (helps regulate appetite and blood sugar)
    • GIP (supports insulin response)
    • Glucagon (affects energy use and fat metabolism)

    By targeting all three, the medication delays how fast your stomach digests food, lowers your appetite, and ultimately reduces how much food you eat. This can lead to numerous improvements in health, including:

    • Weight loss
    • Improved glycemic control (a.k.a. how well your blood sugar is managed)
    • Lower blood pressure
    • Better liver and kidney health

    But retatrutide does still carry the risk for side effects that most in this category do, most commonly GI issues like nausea, constipation, or vomiting. While higher doses of retatrutide are linked to more weight loss, dosing is titrated up over time, just like with other injectables. When retatrutide does become available, we suspect the guidance will be the same “low and slow” approach to upping doses.

    You should also go over all medications you currently take, such as glucose-lowering diabetes medications, blood pressure or thyroid meds, or anticoagulants. Retatrutide slows the emptying of your stomach, so it can affect how certain oral medications are absorbed.

    Select optionsDone This product has multiple variants. The options may be chosen on the product page
  • Semaglutide (cartridge without pen)/ 2mg|5mg/10 vials

    Semaglutide (cartridge without pen)/ 2mg|5mg/10 vials

    Price range: $150.00 through $283.00

    Semaglutide (GLP-1 RA) 5mg/vial

     

    Semaglutide is a GLP-1 receptor agonist, meaning that it mimics the action of the human incretin glucagon-like peptide-1 (GLP-1), thereby increasing insulin secretion and increasing blood sugar disposal and improving glycemic control.

    It is used as an antidiabetic medication used for the treatment of type 2 diabetes and long-term weight management.

    It reduces food intake by lowering appetite and slowing down digestion in the stomach, helping to reduce body fat.

    Its half-life in the blood is about 7 days.

    Dosages may vary between users, it’s recommended to start with a low dose and titrate until you reach and maintain the desired effects, dosages can range from 0.25 to 2.5 mg per week.

    Select optionsDone This product has multiple variants. The options may be chosen on the product page
  • Semaglutide 5mg-30mg/10vials

    Semaglutide 5mg-30mg/10vials

    Price range: $34.00 through $145.00

    Semaglutide for weight loss

    Semaglutide, under the brand name Wegovy, can be used for weight loss. You’ll need to meet the criteria to take it, such as having a BMI of overweight (27 to 30) and a weight-related medical condition like prediabetes, or a BMI of obese (30 or more).

    Wegovy comes as an injection. Research has shown that people lose up to 21% of their starting weight after taking 7.2mg a week for 72 weeks.

    How does semaglutide work for weight loss?

    Semaglutide works by binding to GLP-1 receptors and mimicking the actions of the natural hormone GLP-1. This means it sends signals to your brain, reducing your appetite and causing the stomach to empty more slowly, making you feel less hungry and fuller for longer.

    Naturally, GLP-1 only does this after eating, but semaglutide taken once a week will continuously reduce your appetite, so you’ll feel less hungry all the time, not just after eating. It works effectively alongside a diet and exercise plan.

    How do you take semaglutide for weight loss?

    Wegovy is an injection that comes in a pre-filled injection pen containing 4 doses. A doctor or nurse can show you how to use it, and you can find more information on injecting Wegovy safely

     

    Select optionsDone This product has multiple variants. The options may be chosen on the product page
  • Survodutide 10 mg/10 vials

    Survodutide 10 mg/10 vials

    Price range: $279.00 through $409.00

    Survodutide 10mg: The Next Generation of Fat Loss

    For bodybuilders and fitness enthusiasts pushing the limits of leanness, traditional diet and cardio often hit a wall. Welcome to the cutting edge of metabolic science: Dermal Pharma Survodutide. This is not just another appetite suppressant; it’s a potent dual-agonist peptide that targets two key metabolic pathways simultaneously for unprecedented fat loss results. When you buy Survodutide online, you are investing in one of the most powerful tools available for shredding stubborn body fat and achieving that coveted, stage-ready physique.

    What is Survodutide?

    Survodutide (also known as BI 456906) is a novel peptide that acts as a dual agonist for the glucagon-like peptide-1 (GLP-1) and glucagon receptors. This means it mimics the actions of both natural hormones. GLP-1 slows gastric emptying, reduces appetite, and promotes insulin secretion. Glucagon increases energy expenditure by stimulating the liver to break down fat and glycogen. Together, this dual action creates a powerful “calories in vs. calories out” advantage: you eat less and burn more. The National Institutes of Health published a study highlighting the significant weight loss efficacy of this GLP-1/glucagon dual agonist mechanism.

    Survodutide Effects and Benefits

    Dragon Pharma Survodutide offers a profound set of benefits specifically targeted for cutting phases:

    • Extreme Fat Reduction: Promotes a massive caloric deficit by powerfully suppressing appetite and increasing basal metabolic rate, leading to rapid loss of adipose tissue.
    • Appetite Control: Dramatically reduces hunger and food cravings, making it easier to adhere to a strict caloric deficit diet.
    • Improved Metabolic Markers: Can improve insulin sensitivity and help manage blood sugar levels, contributing to overall health during a cut.
    • Muscle Sparing: By creating a deficit primarily through increased energy expenditure and reduced intake, it can be more muscle-sparing than drastic calorie cutting alone, especially when combined with adequate protein intake.

    Dosage and Administration

    Dragon Pharma Survodutide comes as a 10mg lyophilized powder that must be reconstituted with Bacteriostatic Water. Dosing must be approached carefully to manage potential side effects.

    • Starting Dose: 0.5 mg – 1.0 mg, administered once weekly via subcutaneous injection.
    • Titration: The dose can be gradually increased by 0.5 mg – 1.0 mg every 1-2 weeks based on tolerance and weight loss response.
    • Maintenance Dose: The effective dose for significant weight loss typically ranges between 2.0 mg and 4.0 mg per week. Do not exceed recommended protocols.
    • Cycle Length: Cycles typically run for 12-16 weeks. A break is recommended before starting a new cycle.

    Always consult with a healthcare professional before use and start low to assess your individual tolerance.

    Select optionsDone This product has multiple variants. The options may be chosen on the product page
  • Tesamorelin (2mg,5mg,10mg,20mg)/10 vials

    Tesamorelin (2mg,5mg,10mg,20mg)/10 vials

    Price range: $43.00 through $471.00

    Tesamorelin Peptide
    Tesamorelin is a synthetic polypeptide composed of 44 amino acids analogous to growth hormone-releasing hormone. The N-terminus of the compound has been modified compared to growth hormone-releasing hormone, the modification of which researchers suggest may lead to improved stability.(1)

    Tesamorelin has been studied for its potential mechanism of action, posited to be similar to growth hormone-releasing hormones (GHRH) receptors located at the anterior pituitary gland, possibly leading to increased production and secretion of growth hormones. Growth hormones may act on several cells, including hepatocytes, stimulating the systemic synthesis of insulin-like growth factor-1 (IGF-1). In addition, growth hormone may also stimulate IGF-1 production locally, inside various tissues.(1)

    Usage and Storage:

    Tesamorelin is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website’s detailed reconstitution and storage guidelines.

    Synthesis and Quality Assurance:

    Tesamorelin is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

    Legal and Safety Information:

    Dermal Fillers Pharm proudly provides Tesamorelin strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including Tesamorelin, are not designed for human consumption or clinical application.

    Select optionsDone This product has multiple variants. The options may be chosen on the product page
  • Thymosin Beta 4 TB500 2mg-10mg/10 vials

    Thymosin Beta 4 TB500 2mg-10mg/10 vials

    Price range: $34.00 through $204.00

    TB-500 – High-Quality Research Peptide

    TB-500, offered at 5mg, is a high-quality, specialised research peptide developed for advanced scientific exploration in cellular regeneration and tissue repair. This product is ideal for laboratory settings where precision and reliability are paramount.

    • Product Name: TB-500 5mg
    • Catalogue Number: TB500-5mg
    • Molecular Formula: C212H350N56O78S
    • Molecular Weight: 4963.4 g/mol
    • Purity: ≥98%
    • Sequence:SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
    • Form: Lyophilised Solid

    Usage and Storage:

    TB-500 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website’s detailed reconstitution and storage guidelines.

    Please note that our peptides, including TB-500, are not designed for human consumption or clinical application.

    Select optionsDone This product has multiple variants. The options may be chosen on the product page
  • Tirzepatide (cartridge without pen) 2.5mg/5mg/10mg/15mg| 10 vials

    Tirzepatide (cartridge without pen) 2.5mg/5mg/10mg/15mg| 10 vials

    Price range: $214.00 through $723.00

    (tirzepatide) is a once-weekly, FDA-approved GLP-1 medication used to manage weight gain. Average weight loss is 15-20% of body weight in 12 months.
    Though life-changing medications like semaglutide (Ozempic, Wegovy) and Tirzepatide (Mounjaro, Zepbound) are only approved right now for type 2 diabetes, many people living with type 1 diabetes have started using them as well.

    Select optionsDone This product has multiple variants. The options may be chosen on the product page
  • Tirzepatide 5mg-120mg \ 10 Vials

    Tirzepatide 5mg-120mg \ 10 Vials

    Price range: $39.00 through $440.00
    1. Introducing Tirzepatide: A Revolutionary Breakthrough in Diabetes Management. This advanced medication offers a multi-faceted approach to empower individuals in their journey toward better health.

    Key Features:

    1. Comprehensive Blood Sugar Control:Tirzepatide is designed to effectively regulate blood sugar levels, providing a stable foundation for diabetes management.
    2. Weight Management: Experience the potential for weight loss as part of your diabetes treatment plan, supporting overall health and well-being.
    3. Cardiovascular Support: Tirzepatide goes beyond blood sugar control, offering potential cardiovascular benefits and reducing associated risks.
    4. A1c Improvement: Witness improvements in A1c levels, indicating better long-term glucose management.
    5. Enhanced Insulin Sensitivity: Enjoy the benefits of increased insulin sensitivity for improved metabolic function.
    6. Appetite Regulation: Tirzepatide may contribute to appetite regulation, fostering healthier eating habits.
    7. Convenient Once-Weekly Dosing:Simplify your routine with the potential for once-weekly dosing, enhancing medication adherence
    Select optionsDone This product has multiple variants. The options may be chosen on the product page