Showing all 16 results

  • 5-amino-1mq 5mg/50mg| 10 Vials

    5-amino-1mq 5mg/50mg| 10 Vials

    Price range: $43.00 through $126.00

    5-amino-1mq 5mg/50mg| 10 Vials is a premium research compound designed for laboratory studies focusing on metabolic function and cellular energy regulation. Supplied in multiple vial strengths, it offers flexibility, precision, and consistency for structured experimental protocols.

    Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page
  • Cagrilintide 5mg/10mg| 10vials

    Cagrilintide 5mg/10mg| 10vials

    Price range: $103.00 through $299.00

    Cagrilintide 5mg/10mg| 10vials is a premium research peptide designed for laboratory studies focused on appetite regulation and metabolic function. Supplied in lyophilized form with flexible dosing strengths, it ensures precision, consistency, and reliability for structured experimental protocols.

    Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page
  • GHK-Cu 50mg/100mg| 10 vials

    GHK-Cu 50mg/100mg | 10 vials

    Price range: $26.00 through $69.00

    GHK-Cu 50mg/100mg| 10 vials is a premium copper peptide complex designed for advanced laboratory research. Known for its role in collagen synthesis, tissue repair, and skin regeneration, this peptide is supplied in high-purity lyophilized form for precision and consistency across experimental protocols.

    Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page
  • Buy IGF-1 LR3

    IGF-1 LR3

    Price range: $34.00 through $245.00

    Boost your muscle growth and speed up recovery with IGF-1 LR3. This advanced peptide stimulates protein synthesis, promotes cell regeneration, and helps athletes and bodybuilders achieve lean muscle gains faster. Safe, effective, and long-lasting, IGF-1 LR3 is ideal for anyone serious about peak performance and faster recovery after intense workouts.

    Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page
  • KISSPEPTIN 10 - 5mg/10mg| 10 vials

    KISSPEPTIN 10 – 5mg/10mg| 10 vials

    Price range: $54.00 through $126.00

    KISSPEPTIN 10 – 5mg/10mg| 10 vials is a premium research peptide formulated for laboratory studies involving hormonal regulation and reproductive biology. Supplied in lyophilized form with flexible dosing strengths, it ensures consistency, precision, and reliability for structured experimental protocols.

    Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page
  • MOTS-C ( 10,20,30,40mg)/10 vails

    MOTS-C ( 10,20,30,40mg)/10 vails

    Price range: $54.00 through $314.00
    • MOTS-c Peptide

    MOTS-c (mitochondrial open-reading-frame of the 12S rRNA-c) peptide is a novel mitochondria-derived peptide. It is a short peptide composed of 16 amino acids, expressed in tissues and plasma, indicating a cell-specific and hormonal role.(1) With the potential to work both as a cell-specific compound and as a hormone, this peptide possibly acts by stimulating the AMP-activated protein kinase (AMPK) pathway. Only two mitochondrial-derived peptides (MDPs) have been studied, Humanin and MOTS-c. When metabolic stress occurs in the organism, the peptide is believed to translocate to the cellular nuclei and alter the gene expression. MOTS-c peptide may also be released extracellularly and is known as “mitochondrial hormone” or simply as “mitokine.(2)(3)

    Usage and Storage:

    MOTS-c Acetate is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website’s detailed reconstitution and storage guidelines.

    Synthesis and Quality Assurance:

    MOTS-c Acetate is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

    Legal and Safety Information:

    Dermal Fillers Pharms proudly provides MOTS-c Acetate strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including MOTS-c Acetate, are not designed for human consumption or clinical application.

    Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page
  • Mounjaro 12.5mg/2.4ml x 1 Weight Loss Pen

    Mounjaro 2.5mg|5mg|10mg|15mg x 1 Weight Loss Pen

    Price range: $214.00 through $723.00

    Each pre-filled pen contains 12.5 mg of tirzepatide in 0.6 ml solution.

    Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page
  • Placeholder

    NAD+ 1,000mg Injections

    How Do NAD+ Injections Work? HydraMed’s NAD+ Injection Therapy works by replenishing your body’s NAD+ stores, delivering results in three key areas: Cellular Energy Production NAD+ powers mitochondria, the energy centers of your cells, leading to improved energy levels, reduced fatigue, and enhanced physical performance. Cognitive Clarity NAD+ supports brain health by combating oxidative stress,…

  • Retatrutide | 99% Purity | 5mg - 60mg / 10 vials

    Retatrutide | 99% Purity | 5mg – 60mg / 10 vials

    Price range: $64.00 through $644.00

    What Is Retatrutide?

    Similar to other GLP-1 medications, retatrutide is an injectable medication that targets hormone receptors in your body that directly impact metabolism and appetite. Retatrutide targets three different receptors:

    • GLP-1 (helps regulate appetite and blood sugar)
    • GIP (supports insulin response)
    • Glucagon (affects energy use and fat metabolism)

    By targeting all three, the medication delays how fast your stomach digests food, lowers your appetite, and ultimately reduces how much food you eat. This can lead to numerous improvements in health, including:

    • Weight loss
    • Improved glycemic control (a.k.a. how well your blood sugar is managed)
    • Lower blood pressure
    • Better liver and kidney health

    But retatrutide does still carry the risk for side effects that most in this category do, most commonly GI issues like nausea, constipation, or vomiting. While higher doses of retatrutide are linked to more weight loss, dosing is titrated up over time, just like with other injectables. When retatrutide does become available, we suspect the guidance will be the same “low and slow” approach to upping doses.

    You should also go over all medications you currently take, such as glucose-lowering diabetes medications, blood pressure or thyroid meds, or anticoagulants. Retatrutide slows the emptying of your stomach, so it can affect how certain oral medications are absorbed.

    Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page
  • Semaglutide

    Semaglutide (cartridge without pen)/ 2mg|5mg/10 vials

    Price range: $150.00 through $283.00

    Semaglutide (GLP-1 RA) 5mg/vial

     

    Semaglutide is a GLP-1 receptor agonist, meaning that it mimics the action of the human incretin glucagon-like peptide-1 (GLP-1), thereby increasing insulin secretion and increasing blood sugar disposal and improving glycemic control.

    It is used as an antidiabetic medication used for the treatment of type 2 diabetes and long-term weight management.

    It reduces food intake by lowering appetite and slowing down digestion in the stomach, helping to reduce body fat.

    Its half-life in the blood is about 7 days.

    Dosages may vary between users, it’s recommended to start with a low dose and titrate until you reach and maintain the desired effects, dosages can range from 0.25 to 2.5 mg per week.

    Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page
  • Semaglutide 5mg-30mg/10vials

    Semaglutide 5mg-30mg/10vials

    Price range: $34.00 through $145.00

    Semaglutide for weight loss

    Semaglutide, under the brand name Wegovy, can be used for weight loss. You’ll need to meet the criteria to take it, such as having a BMI of overweight (27 to 30) and a weight-related medical condition like prediabetes, or a BMI of obese (30 or more).

    Wegovy comes as an injection. Research has shown that people lose up to 21% of their starting weight after taking 7.2mg a week for 72 weeks.

    How does semaglutide work for weight loss?

    Semaglutide works by binding to GLP-1 receptors and mimicking the actions of the natural hormone GLP-1. This means it sends signals to your brain, reducing your appetite and causing the stomach to empty more slowly, making you feel less hungry and fuller for longer.

    Naturally, GLP-1 only does this after eating, but semaglutide taken once a week will continuously reduce your appetite, so you’ll feel less hungry all the time, not just after eating. It works effectively alongside a diet and exercise plan.

    How do you take semaglutide for weight loss?

    Wegovy is an injection that comes in a pre-filled injection pen containing 4 doses. A doctor or nurse can show you how to use it, and you can find more information on injecting Wegovy safely

     

    Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page
  • Survodutide 10mg| 10 vials

    Survodutide 10mg | 10 vials

    Price range: $279.00 through $409.00

    Survodutide 10mg| 10 vials is a premium research peptide developed for laboratory studies focusing on metabolic regulation and energy balance. Supplied in lyophilized form, it ensures precision, consistency, and high purity for structured experimental protocols.

    Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page
  • Tesamorelin (2mg,5mg,10mg,20mg)/10 vials

    Tesamorelin (2mg,5mg,10mg,20mg)/10 vials

    Price range: $43.00 through $471.00

    Tesamorelin Peptide
    Tesamorelin is a synthetic polypeptide composed of 44 amino acids analogous to growth hormone-releasing hormone. The N-terminus of the compound has been modified compared to growth hormone-releasing hormone, the modification of which researchers suggest may lead to improved stability.(1)

    Tesamorelin has been studied for its potential mechanism of action, posited to be similar to growth hormone-releasing hormones (GHRH) receptors located at the anterior pituitary gland, possibly leading to increased production and secretion of growth hormones. Growth hormones may act on several cells, including hepatocytes, stimulating the systemic synthesis of insulin-like growth factor-1 (IGF-1). In addition, growth hormone may also stimulate IGF-1 production locally, inside various tissues.(1)

    Usage and Storage:

    Tesamorelin is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website’s detailed reconstitution and storage guidelines.

    Synthesis and Quality Assurance:

    Tesamorelin is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

    Legal and Safety Information:

    Dermal Fillers Pharm proudly provides Tesamorelin strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including Tesamorelin, are not designed for human consumption or clinical application.

    Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page
  • Thymosin Beta 4 TB500 2mg-10mg/10 vials

    Thymosin Beta 4 TB500 2mg-10mg/10 vials

    Price range: $34.00 through $204.00

    TB-500 – High-Quality Research Peptide

    TB-500, offered at 5mg, is a high-quality, specialised research peptide developed for advanced scientific exploration in cellular regeneration and tissue repair. This product is ideal for laboratory settings where precision and reliability are paramount.

    • Product Name: TB-500 5mg
    • Catalogue Number: TB500-5mg
    • Molecular Formula: C212H350N56O78S
    • Molecular Weight: 4963.4 g/mol
    • Purity: ≥98%
    • Sequence:SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
    • Form: Lyophilised Solid

    Usage and Storage:

    TB-500 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website’s detailed reconstitution and storage guidelines.

    Please note that our peptides, including TB-500, are not designed for human consumption or clinical application.

    Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page
  • Tirzepatide (Zepbound and Mounjaro) 2.5mg/5mg/10mg/15mg| 10 vials

    Tirzepatide (Zepbound and Mounjaro) 2.5mg/5mg/10mg/15mg| 10 vials

    Price range: $214.00 through $723.00

    Tirzepatide (Zepbound and Mounjaro) 2.5mg/5mg/10mg/15mg| 10 vials is a high-quality research peptide designed for laboratory studies focusing on dual incretin receptor activity. Supplied in multiple strengths, it offers flexibility, precision, and consistency for structured experimental protocols in metabolic and endocrine research.

    Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page
  • Tirzepatide 5mg-120mg \ 10 Vials

    Tirzepatide 5mg-120mg \ 10 Vials

    Price range: $39.00 through $440.00
    1. Introducing Tirzepatide: A Revolutionary Breakthrough in Diabetes Management. This advanced medication offers a multi-faceted approach to empower individuals in their journey toward better health.

    Key Features:

    1. Comprehensive Blood Sugar Control:Tirzepatide is designed to effectively regulate blood sugar levels, providing a stable foundation for diabetes management.
    2. Weight Management: Experience the potential for weight loss as part of your diabetes treatment plan, supporting overall health and well-being.
    3. Cardiovascular Support: Tirzepatide goes beyond blood sugar control, offering potential cardiovascular benefits and reducing associated risks.
    4. A1c Improvement: Witness improvements in A1c levels, indicating better long-term glucose management.
    5. Enhanced Insulin Sensitivity: Enjoy the benefits of increased insulin sensitivity for improved metabolic function.
    6. Appetite Regulation: Tirzepatide may contribute to appetite regulation, fostering healthier eating habits.
    7. Convenient Once-Weekly Dosing:Simplify your routine with the potential for once-weekly dosing, enhancing medication adherence
    Select optionsLoading Done This product has multiple variants. The options may be chosen on the product page