Thymosin Beta 4 TB500 2mg-10mg/10 vials
Price range: $34.00 through $204.00
TB-500 – High-Quality Research Peptide
TB-500, offered at 5mg, is a high-quality, specialised research peptide developed for advanced scientific exploration in cellular regeneration and tissue repair. This product is ideal for laboratory settings where precision and reliability are paramount.
- Product Name: TB-500 5mg
- Catalogue Number: TB500-5mg
- Molecular Formula: C212H350N56O78S
- Molecular Weight: 4963.4 g/mol
- Purity: ≥98%
- Sequence:SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Form: Lyophilised Solid
Usage and Storage:
TB-500 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website’s detailed reconstitution and storage guidelines.
Please note that our peptides, including TB-500, are not designed for human consumption or clinical application.
Description
Synthesis and Quality Assurance:
TB-500 is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.
Legal and Safety Information:
Derma fillers-Peptides proudly provides TB-500 strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements.
Additional information
| Content per Kit | 2mg, 5mg, 10mg |
|---|---|
| Packing ( Vials ) | 1kit, 10kits, 50kits, 100kits |
Related products
-
Tesamorelin (2mg,5mg,10mg,20mg)/10 vials
Price range: $43.00 through $471.00Select options This product has multiple variants. The options may be chosen on the product page -
KISSPEPTIN 10 – 5mg/10mg| 10 vials
Price range: $54.00 through $126.00Select options This product has multiple variants. The options may be chosen on the product page -
-
MOTS-C ( 10,20,30,40mg)/10 vails
Price range: $54.00 through $314.00Select options This product has multiple variants. The options may be chosen on the product page
Reviews
There are no reviews yet.